PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013628064.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 426aa    MW: 49830.1 Da    PI: 7.4036
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013628064.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-19215261148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +lv++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
   XP_013628064.1 215 KGQWTAEEDRILVQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 261
                      799*****************************.*************97 PP

2Myb_DNA-binding50.64.5e-16267309145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W+++Ed  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
   XP_013628064.1 267 KETWSEDEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 309
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.936210265IPR017930Myb domain
SuperFamilySSF466892.41E-32213308IPR009057Homeodomain-like
SMARTSM007176.2E-18214263IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-28216268IPR009057Homeodomain-like
PfamPF139211.1E-19218275No hitNo description
CDDcd001674.57E-16218261No hitNo description
PROSITE profilePS5129420.569266316IPR017930Myb domain
SMARTSM007171.2E-15266314IPR001005SANT/Myb domain
CDDcd001679.06E-12269312No hitNo description
Gene3DG3DSA:1.10.10.601.1E-21269314IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MENYVDESGF ATLNLTKFTR DEEHMKEEDF PFEVVDQSKP TSFLQDFHHL DHDHQFDHHY  60
HHHHGSTSSN PLLGAPRTLS CINKVPLQHC SYQENLVDFY ESKPHLMNHH FQASDNQYFT  120
RDHHQEIRLV DEHNPVDLEQ NNMMMMRMLP FEYPPTAIIK PTNFMMPDEV SCVSADNNCY  180
KAMSFNKTKP FLTRNLSSSS SSSSWKGKNN TTLVKGQWTA EEDRILVQLV EKYGLRKWSH  240
IAQVLPGRIG KQCRERWHNH LRPDIKKETW SEDEDRVLIE FHKEIGNKWA EIAKRLPGRT  300
ENSIKNHWNA TKRRQFSKRK CRSKYPRPSL LQDYIKSLDL GVLSSSSVPA RGRRKESNKK  360
KDIVAVEEKR KKKKEEKFYG QDRAVPECVF ADGFGFNENL LEEGCSIDSL LDDFPQVDID  420
AFVHGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-4419531638159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-4419531638159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-442133162105C-Myb DNA-Binding Domain
1msf_C1e-442133162105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358373KKKDIVAVEEKRKKKK
2369374RKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628064.10.0PREDICTED: transcription factor MYB98-like
RefseqXP_013701411.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D3BKC80.0A0A0D3BKC8_BRAOL; Uncharacterized protein
STRINGBra020992.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98